NAT2 antibody (70R-1804)

Rabbit polyclonal NAT2 antibody

Synonyms Polyclonal NAT2 antibody, Anti-NAT2 antibody, N-Acetyltransferase 2 antibody, Arylamine N-Acetyltransferase antibody, NAT2, NAT-2, NAT 2 antibody, NAT 2, AAC2 antibody, NAT-2 antibody
Cross Reactivity Human
Applications WB
Immunogen NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE
Assay Information NAT2 Blocking Peptide, catalog no. 33R-1747, is also available for use as a blocking control in assays to test for specificity of this NAT2 antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NAT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors