NDFIP2 antibody (70R-4486)

Rabbit polyclonal NDFIP2 antibody raised against the middle region of NDFIP2

Synonyms Polyclonal NDFIP2 antibody, Anti-NDFIP2 antibody, N4wbp5a antibody, NDFIP 2, FLJ25842 antibody, Nedd4 Family Interacting Protein 2 antibody, NDFIP2, NDFIP-2 antibody, NDFIP 2 antibody, KIAA1165 antibody, NDFIP-2
Specificity NDFIP2 antibody was raised against the middle region of NDFIP2
Cross Reactivity Human
Applications WB
Immunogen NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
Assay Information NDFIP2 Blocking Peptide, catalog no. 33R-8419, is also available for use as a blocking control in assays to test for specificity of this NDFIP2 antibody


Western Blot analysis using NDFIP2 antibody (70R-4486)

NDFIP2 antibody (70R-4486) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDFIP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, NDFIP2 may control many cellular processes. NDFIP2 recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. NDFIP2 may modulate EGFR signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDFIP2 antibody (70R-4486) | NDFIP2 antibody (70R-4486) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors