NDRG2 antibody (70R-3773)

Rabbit polyclonal NDRG2 antibody raised against the C terminal of NDRG2

Synonyms Polyclonal NDRG2 antibody, Anti-NDRG2 antibody, NDRG-2, NDRG 2 antibody, KIAA1248 antibody, NDRG-2 antibody, NDRG2, FLJ25522 antibody, DKFZp781G1938 antibody, Ndrg Family Member 2 antibody, NDRG 2, SYLD antibody
Specificity NDRG2 antibody was raised against the C terminal of NDRG2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
Assay Information NDRG2 Blocking Peptide, catalog no. 33R-3680, is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody


Immunohistochemical staining using NDRG2 antibody (70R-3773)



Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDRG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NDRG2 antibody (70R-3773) | Liver
  • Western blot analysis using NDRG2 antibody (70R-3773) | Recommended NDRG2 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors