NEDD4L antibody (70R-2633)

Rabbit polyclonal NEDD4L antibody raised against the middle region of NEDD4L

Synonyms Polyclonal NEDD4L antibody, Anti-NEDD4L antibody, Neural Precursor Cell Expressed Developmentally Down-Regulated 4-Like antibody, FLJ33870 antibody, RSP5 antibody, NEDDL-4, NEDDL-4 antibody, NEDDL 4 antibody, KIAA0439 antibody, hNedd4-2 antibody, NEDD4L, NEDDL 4
Specificity NEDD4L antibody was raised against the middle region of NEDD4L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NEDD4L antibody was raised using the middle region of NEDD4L corresponding to a region with amino acids TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP
Assay Information NEDD4L Blocking Peptide, catalog no. 33R-9373, is also available for use as a blocking control in assays to test for specificity of this NEDD4L antibody


Western Blot analysis using NEDD4L antibody (70R-2633)

NEDD4L antibody (70R-2633) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEDD4L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEDD4L antibody (70R-2633) | NEDD4L antibody (70R-2633) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors