NELL2 antibody (70R-1709)
Rabbit polyclonal NELL2 antibody
Overview
Overview
Synonyms | Polyclonal NELL2 antibody, Anti-NELL2 antibody, NELL2, Nel-Like 2 antibody, NELL-2, NELL-2 antibody, NELL 2 antibody, NRP2 antibody, NELL 2 |
---|---|
Cross Reactivity | Human,Mouse |
Applications | WB |
Immunogen | NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG |
Assay Information | NELL2 Blocking Peptide, catalog no. 33R-5966, is also available for use as a blocking control in assays to test for specificity of this NELL2 antibody |
Images
Western Blot analysis using NELL2 antibody (70R-1709)
NELL2 antibody (70R-1709) used at 5 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Total IgG Protein A purified |
Molecular Weight | 91 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NELL2 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 5 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product