NELL2 antibody (70R-1709)

Rabbit polyclonal NELL2 antibody

Synonyms Polyclonal NELL2 antibody, Anti-NELL2 antibody, NELL2, Nel-Like 2 antibody, NELL-2, NELL-2 antibody, NELL 2 antibody, NRP2 antibody, NELL 2
Cross Reactivity Human,Mouse
Applications WB
Immunogen NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
Assay Information NELL2 Blocking Peptide, catalog no. 33R-5966, is also available for use as a blocking control in assays to test for specificity of this NELL2 antibody


Western Blot analysis using NELL2 antibody (70R-1709)

NELL2 antibody (70R-1709) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NELL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NELL2 antibody (70R-1709) | NELL2 antibody (70R-1709) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors