Nestin antibody (70R-5230)

Rabbit polyclonal Nestin antibody raised against the middle region of NES

Synonyms Polyclonal Nestin antibody, Anti-Nestin antibody, FLJ21841 antibody, Nbla00170 antibody, NES antibody
Specificity Nestin antibody was raised against the middle region of NES
Cross Reactivity Human
Applications WB
Immunogen Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
Assay Information Nestin Blocking Peptide, catalog no. 33R-5261, is also available for use as a blocking control in assays to test for specificity of this Nestin antibody

Images

Western blot analysis using Nestin antibody (70R-5230)

Recommended NES Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 177 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NES antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Nestin antibody (70R-5230) | Recommended NES Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using Nestin antibody (70R-5230) | Heart
  • Western blot analysis using Nestin antibody (70R-5230) | Recommended NES Antibody Positive Control: Lane1: 25ug mouse NIH3T3 lysate, Lane2: 25ug mouse embryonic stem cell lysate, Lane3: 25ug mouse neural stem cell lysate; Antibody Dilution: 1:500

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors