NEU1 antibody (70R-1866)

Rabbit polyclonal NEU1 antibody

Synonyms Polyclonal NEU1 antibody, Anti-NEU1 antibody, Neu-1 antibody, NEU antibody, Neu 1, Neu-1, SIAL1 antibody, Neu1, Neu 1 antibody, Lysosomal Sialidase antibody, Sialidase 1 antibody
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
Assay Information NEU1 Blocking Peptide, catalog no. 33R-9913, is also available for use as a blocking control in assays to test for specificity of this NEU1 antibody


Immunohistochemical staining using NEU1 antibody (70R-1866)

NEU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NEU1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NEU1 antibody (70R-1866) | NEU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using NEU1 antibody (70R-1866) | NEU1 antibody (70R-1866) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using NEU1 antibody (70R-1866) | NEU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors