NEURL antibody (70R-5243)

Rabbit polyclonal NEURL antibody

Synonyms Polyclonal NEURL antibody, Anti-NEURL antibody, NEURL1 antibody, RNF67 antibody, h-neu antibody, Neuralized Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen NEURL antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKA
Assay Information NEURL Blocking Peptide, catalog no. 33R-8032, is also available for use as a blocking control in assays to test for specificity of this NEURL antibody


Western Blot analysis using NEURL antibody (70R-5243)

NEURL antibody (70R-5243) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEURL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEURL may be involved in protein binding, zinc ion binding and metal ion binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEURL antibody (70R-5243) | NEURL antibody (70R-5243) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors