Neurochondrin antibody (70R-3685)

Rabbit polyclonal Neurochondrin antibody raised against the N terminal of NCDN

Synonyms Polyclonal Neurochondrin antibody, Anti-Neurochondrin antibody, NCDN antibody, KIAA0607 antibody
Specificity Neurochondrin antibody was raised against the N terminal of NCDN
Cross Reactivity Human
Applications WB
Immunogen Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS
Assay Information Neurochondrin Blocking Peptide, catalog no. 33R-6403, is also available for use as a blocking control in assays to test for specificity of this Neurochondrin antibody


Western Blot analysis using Neurochondrin antibody (70R-3685)

Neurochondrin antibody (70R-3685) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCDN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Neurochondrin antibody (70R-3685) | Neurochondrin antibody (70R-3685) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors