NIP7 antibody (70R-4952)

Rabbit polyclonal NIP7 antibody

Synonyms Polyclonal NIP7 antibody, Anti-NIP7 antibody, Nuclear Import 7 Homolog antibody, NIP-7, NIP 7 antibody, NIP 7, NIP7, NIP-7 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST
Assay Information NIP7 Blocking Peptide, catalog no. 33R-7091, is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody


Western Blot analysis using NIP7 antibody (70R-4952)

NIP7 antibody (70R-4952) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NIP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NIP7 antibody (70R-4952) | NIP7 antibody (70R-4952) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors