NMRAL1 antibody (70R-3374)

Rabbit polyclonal NMRAL1 antibody raised against the middle region of NMRAL1

Synonyms Polyclonal NMRAL1 antibody, Anti-NMRAL1 antibody, NMRAL-1, NMRAL1, NMRAL-1 antibody, Nmra-Like Family Domain Containing 1 antibody, NMRAL 1, FLJ25918 antibody, HSCARG antibody, NMRAL 1 antibody
Specificity NMRAL1 antibody was raised against the middle region of NMRAL1
Cross Reactivity Human
Applications WB
Immunogen NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA
Assay Information NMRAL1 Blocking Peptide, catalog no. 33R-8999, is also available for use as a blocking control in assays to test for specificity of this NMRAL1 antibody


Western blot analysis using NMRAL1 antibody (70R-3374)

Recommended NMRAL1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NMRAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein is binding, oxidoreductase activity and transcription repressor activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NMRAL1 antibody (70R-3374) | Recommended NMRAL1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors