NOVA2 antibody (70R-1469)

Rabbit polyclonal NOVA2 antibody raised against the N terminal of NOVA2

Synonyms Polyclonal NOVA2 antibody, Anti-NOVA2 antibody, Neuro-Oncological Ventral Antigen 2 antibody, NOVA-2 antibody, NOVA 2 antibody, NOVA-2, NOVA2, NOVA 2
Specificity NOVA2 antibody was raised against the N terminal of NOVA2
Cross Reactivity Human,ZebraFish
Applications WB
Immunogen NOVA2 antibody was raised using the N terminal of NOVA2 corresponding to a region with amino acids MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK
Assay Information NOVA2 Blocking Peptide, catalog no. 33R-5942, is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody


Western Blot analysis using NOVA2 antibody (70R-1469)

NOVA2 antibody (70R-1469) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NOVA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOVA2 antibody (70R-1469) | NOVA2 antibody (70R-1469) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors