NR0B1 antibody (70R-1933)

Rabbit polyclonal NR0B1 antibody raised against the middle region of NR0B1

Synonyms Polyclonal NR0B1 antibody, Anti-NR0B1 antibody, HHG antibody, DAX-1 antibody, Nuclear Receptor Subfamily 0 Group B Member 1 antibody, GTD antibody, AHC antibody, NROB1 antibody, DAX1 antibody, AHCH antibody, AHX antibody, DSS antibody
Specificity NR0B1 antibody was raised against the middle region of NR0B1
Cross Reactivity Human
Applications WB
Immunogen NR0B1 antibody was raised using the middle region of NR0B1 corresponding to a region with amino acids FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS
Assay Information NR0B1 Blocking Peptide, catalog no. 33R-2852, is also available for use as a blocking control in assays to test for specificity of this NR0B1 antibody


Western blot analysis using NR0B1 antibody (70R-1933)

Recommended NR0B1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR0B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR0B1 antibody (70R-1933) | Recommended NR0B1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors