NR0B2 antibody (70R-1928)

Rabbit polyclonal NR0B2 antibody raised against the middle region of NR0B2

Synonyms Polyclonal NR0B2 antibody, Anti-NR0B2 antibody, Nuclear Receptor Subfamily 0 Group B Member 2 antibody, SHP1 antibody, SHP antibody
Specificity NR0B2 antibody was raised against the middle region of NR0B2
Cross Reactivity Human
Applications WB
Immunogen NR0B2 antibody was raised using the middle region of NR0B2 corresponding to a region with amino acids AEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSL
Assay Information NR0B2 Blocking Peptide, catalog no. 33R-1113, is also available for use as a blocking control in assays to test for specificity of this NR0B2 antibody


Western blot analysis using NR0B2 antibody (70R-1928)

Recommended NR0B2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR0B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR0B2 is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. It is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR0B2 antibody (70R-1928) | Recommended NR0B2 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using NR0B2 antibody (70R-1928) | Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using NR0B2 antibody

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors