NR1D1 antibody (70R-1926)

Rabbit polyclonal NR1D1 antibody raised against the middle region of NR1D1

Synonyms Polyclonal NR1D1 antibody, Anti-NR1D1 antibody, NRD 1, NRD-1 antibody, EAR1 antibody, THRA1 antibody, hRev antibody, NRD-1, Nuclear Receptor Subfamily 1 Group D Member 1 antibody, THRAL antibody, ear-1 antibody, NR1D1, NRD 1 antibody
Specificity NR1D1 antibody was raised against the middle region of NR1D1
Cross Reactivity Human,Rat
Applications WB
Immunogen NR1D1 antibody was raised using the middle region of NR1D1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA
Assay Information NR1D1 Blocking Peptide, catalog no. 33R-8729, is also available for use as a blocking control in assays to test for specificity of this NR1D1 antibody

Images

Western blot analysis using NR1D1 antibody (70R-1926)

Recommended NR1D1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR1D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR1D1 belongs to the nuclear hormone receptor family, NR1 subfamily. It contains 1 nuclear receptor DNA-binding domain. NR1D1 functions as a constitutive transcriptional repressor. It is a possible receptor for triiodothyronine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using NR1D1 antibody (70R-1926) | Recommended NR1D1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors