NR1H4 antibody (70R-1941)

Rabbit polyclonal NR1H4 antibody raised against the middle region of NR1H4

Synonyms Polyclonal NR1H4 antibody, Anti-NR1H4 antibody, HRR1 antibody, NR1H4, NRH4 1 antibody, RIP14 antibody, NRH4-1 antibody, FXR antibody, MGC163445 antibody, NRH4 1, Nuclear Receptor Subfamily 1 Group H Member 4 antibody, NRH4-1, BAR antibody, HRR-1 antibody
Specificity NR1H4 antibody was raised against the middle region of NR1H4
Cross Reactivity Human
Applications WB
Immunogen NR1H4 antibody was raised using the middle region of NR1H4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI
Assay Information NR1H4 Blocking Peptide, catalog no. 33R-8322, is also available for use as a blocking control in assays to test for specificity of this NR1H4 antibody


Western blot analysis using NR1H4 antibody (70R-1941)

Recommended NR1H4 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR1H4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR1H4 antibody (70R-1941) | Recommended NR1H4 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors