NR1I3 antibody (70R-1002)

Rabbit polyclonal NR1I3 antibody raised against the N terminal of NR1I3

Synonyms Polyclonal NR1I3 antibody, Anti-NR1I3 antibody, NR1I3, Nuclear Receptor Subfamily 1 Group I Member 3 antibody, MGC150433 antibody, NRI3-1 antibody, NRI3-1, NRI3 1 antibody, CAR1 antibody, MGC97209 antibody, NRI3 1, MB67 antibody, CAR antibody, MGC97144 antibody
Specificity NR1I3 antibody was raised against the N terminal of NR1I3
Cross Reactivity Human
Applications IHC, WB
Immunogen NR1I3 antibody was raised using the N terminal of NR1I3 corresponding to a region with amino acids MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA
Assay Information NR1I3 Blocking Peptide, catalog no. 33R-5759, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody


Western blot analysis using NR1I3 antibody (70R-1002)

Recommended NR1I3 Antibody Titration: 1.25ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NR1I3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR1I3 antibody (70R-1002) | Recommended NR1I3 Antibody Titration: 1.25ug/ml
  • Immunohistochemical staining using NR1I3 antibody (70R-1002) | Human Liver

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors