NR1I3 antibody (70R-2541)

Rabbit polyclonal NR1I3 antibody raised against the middle region of NR1I3

Synonyms Polyclonal NR1I3 antibody, Anti-NR1I3 antibody, NRI3 1, MGC97209 antibody, Nuclear Receptor Subfamily 1 Group I Member 3 antibody, MGC97144 antibody, NRI3 1 antibody, NRI3-1, MGC150433 antibody, NR1I3, MB67 antibody, CAR1 antibody, CAR antibody, NRI3-1 antibody
Specificity NR1I3 antibody was raised against the middle region of NR1I3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NR1I3 antibody was raised using the middle region of NR1I3 corresponding to a region with amino acids PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG
Assay Information NR1I3 Blocking Peptide, catalog no. 33R-7407, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody

Western blot analysis using NR1I3 antibody (70R-2541)

Recommended NR1I3 Antibody Titration: 0.2-1 ug/ml

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR1I3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using NR1I3 antibody (70R-2541) | Recommended NR1I3 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using NR1I3 antibody (70R-2541) | Human Colon lysate tissue at an antibody concentration of 5.0ug/ml using NR1I3 antibody

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors