NR2C2 antibody (70R-1547)

Rabbit polyclonal NR2C2 antibody raised against the C terminal of NR2C2

Synonyms Polyclonal NR2C2 antibody, Anti-NR2C2 antibody, TR2R1 antibody, hTAK1 antibody, TR4 antibody, NRC-2, NRC 2, Nuclear Receptor Subfamily 2 Group C Member 2 antibody, NRC-2 antibody, TAK1 antibody, NR2C2, NRC 2 antibody
Specificity NR2C2 antibody was raised against the C terminal of NR2C2
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen NR2C2 antibody was raised using the C terminal of NR2C2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS
Assay Information NR2C2 Blocking Peptide, catalog no. 33R-1445, is also available for use as a blocking control in assays to test for specificity of this NR2C2 antibody


Immunohistochemical staining using NR2C2 antibody (70R-1547)

NR2C2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NR2C2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NR2C2 antibody (70R-1547) | NR2C2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using NR2C2 antibody (70R-1547) | NR2C2 antibody (70R-1547) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using NR2C2 antibody (70R-1547) | NR2C2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors