NRARP antibody (70R-3353)

Rabbit polyclonal NRARP antibody raised against the middle region of NRARP

Synonyms Polyclonal NRARP antibody, Anti-NRARP antibody, MGC61598 antibody, Notch-Regulated Ankyrin Repeat Protein antibody
Specificity NRARP antibody was raised against the middle region of NRARP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NRARP antibody was raised using the middle region of NRARP corresponding to a region with amino acids QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG
Assay Information NRARP Blocking Peptide, catalog no. 33R-7666, is also available for use as a blocking control in assays to test for specificity of this NRARP antibody


Western Blot analysis using NRARP antibody (70R-3353)

NRARP antibody (70R-3353) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRARP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NRARP may play a role in the formation of somites.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NRARP antibody (70R-3353) | NRARP antibody (70R-3353) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors