NRBP2 antibody (70R-2615)

Rabbit polyclonal NRBP2 antibody raised against the middle region of NRBP2

Synonyms Polyclonal NRBP2 antibody, Anti-NRBP2 antibody, TRG16 antibody, NRBP-2 antibody, DKFZp434P086 antibody, NRBP-2, Nuclear Receptor Binding Protein 2 antibody, NRBP 2, MGC138699 antibody, pp9320 antibody, NRBP2, NRBP 2 antibody
Specificity NRBP2 antibody was raised against the middle region of NRBP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NRBP2 antibody was raised using the middle region of NRBP2 corresponding to a region with amino acids VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL
Assay Information NRBP2 Blocking Peptide, catalog no. 33R-9607, is also available for use as a blocking control in assays to test for specificity of this NRBP2 antibody


Western Blot analysis using NRBP2 antibody (70R-2615)

NRBP2 antibody (70R-2615) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of NRBP2 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NRBP2 antibody (70R-2615) | NRBP2 antibody (70R-2615) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors