NRCAM antibody (70R-1741)

Rabbit polyclonal NRCAM antibody raised against the N terminal of NRCAM

Synonyms Polyclonal NRCAM antibody, Anti-NRCAM antibody, Neuronal Cell Adhesion Molecule antibody, MGC138846 antibody, MGC138845 antibody, KIAA0343 antibody
Specificity NRCAM antibody was raised against the N terminal of NRCAM
Cross Reactivity Human
Applications IHC, WB
Immunogen NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
Assay Information NRCAM Blocking Peptide, catalog no. 33R-6774, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody

Images

Western Blot analysis using NRCAM antibody (70R-1741)

NRCAM antibody (70R-1741) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NRCAM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NRCAM antibody (70R-1741) | NRCAM antibody (70R-1741) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors