NRCAM antibody (70R-1741)

Rabbit polyclonal NRCAM antibody raised against the N terminal of NRCAM

Synonyms Polyclonal NRCAM antibody, Anti-NRCAM antibody, Neuronal Cell Adhesion Molecule antibody, MGC138846 antibody, MGC138845 antibody, KIAA0343 antibody
Specificity NRCAM antibody was raised against the N terminal of NRCAM
Cross Reactivity Human
Applications IHC, WB
Immunogen NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
Assay Information NRCAM Blocking Peptide, catalog no. 33R-6774, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody


Immunohistochemical staining using NRCAM antibody (70R-1741)

NRCAM antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NRCAM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NRCAM antibody (70R-1741) | NRCAM antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using NRCAM antibody (70R-1741) | NRCAM antibody (70R-1741) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors