NSUN5C antibody (70R-1208)

Rabbit polyclonal NSUN5C antibody raised against the middle region of NSUN5C

Synonyms Polyclonal NSUN5C antibody, Anti-NSUN5C antibody, WBSCR20B antibody, MGC129801 antibody, FLJ11626 antibody, NSUN5C, DKFZp434K058 antibody, Nol1/Nop2/Sun Domain Family Member 5C antibody, NSUNC 5, MGC15057 antibody, NSUNC 5 antibody, NOL1R2 antibody, WBSCR20C antibody, NSUNC-5 antibody, DKFZp666P104 antibody, NSUNC-5
Specificity NSUN5C antibody was raised against the middle region of NSUN5C
Cross Reactivity Human
Applications WB
Immunogen NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
Assay Information NSUN5C Blocking Peptide, catalog no. 33R-6965, is also available for use as a blocking control in assays to test for specificity of this NSUN5C antibody

Images

Western Blot analysis using NSUN5C antibody (70R-1208)

NSUN5C antibody (70R-1208) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NSUN5C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NSUN5C antibody (70R-1208) | NSUN5C antibody (70R-1208) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors