NSUN6 antibody (70R-4984)

Rabbit polyclonal NSUN6 antibody raised against the N terminal of NSUN6

Synonyms Polyclonal NSUN6 antibody, Anti-NSUN6 antibody, NSUN6, NSUN-6, 4933414E04Rik antibody, NSUN 6 antibody, NSUN 6, Nol1/Nop2/Sun Domain Family Member 6 antibody, NOPD1 antibody, FLJ23743 antibody, NSUN-6 antibody
Specificity NSUN6 antibody was raised against the N terminal of NSUN6
Cross Reactivity Human
Applications WB
Immunogen NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
Assay Information NSUN6 Blocking Peptide, catalog no. 33R-8525, is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody


Western Blot analysis using NSUN6 antibody (70R-4984)

NSUN6 antibody (70R-4984) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NSUN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NSUN6 antibody (70R-4984) | NSUN6 antibody (70R-4984) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors