NT5C1B antibody (70R-4405)

Rabbit polyclonal NT5C1B antibody raised against the N terminal of NT5C1B

Synonyms Polyclonal NT5C1B antibody, Anti-NT5C1B antibody, NTC1B-5 antibody, MGC26640 antibody, NTC1B 5 antibody, AIRP antibody, 5'-Nucleotidase Cytosolic Ib antibody, NT5C1B, CN-IB antibody, NTC1B-5, NTC1B 5
Specificity NT5C1B antibody was raised against the N terminal of NT5C1B
Cross Reactivity Human
Applications WB
Immunogen NT5C1B antibody was raised using the N terminal of NT5C1B corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT
Assay Information NT5C1B Blocking Peptide, catalog no. 33R-6484, is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody


Western Blot analysis using NT5C1B antibody (70R-4405)

NT5C1B antibody (70R-4405) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NT5C1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NT5C1B antibody (70R-4405) | NT5C1B antibody (70R-4405) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors