NT5M antibody (70R-2441)

Rabbit polyclonal NT5M antibody raised against the middle region of NT5M

Synonyms Polyclonal NT5M antibody, Anti-NT5M antibody, mdN antibody, dNT-2 antibody, NTM-5, NT5M, dNT2 antibody, 5'3'-Nucleotidase Mitochondrial antibody, NTM 5, NTM 5 antibody, NTM-5 antibody
Specificity NT5M antibody was raised against the middle region of NT5M
Cross Reactivity Human
Applications WB
Immunogen NT5M antibody was raised using the middle region of NT5M corresponding to a region with amino acids KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV
Assay Information NT5M Blocking Peptide, catalog no. 33R-4734, is also available for use as a blocking control in assays to test for specificity of this NT5M antibody


Western Blot analysis using NT5M antibody (70R-2441)

NT5M antibody (70R-2441) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NT5M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NT5M antibody (70R-2441) | NT5M antibody (70R-2441) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors