Nucleobindin 2 antibody (70R-1577)

Rabbit polyclonal Nucleobindin 2 antibody raised against the middle region of NUCB2

Synonyms Polyclonal Nucleobindin 2 antibody, Anti-Nucleobindin 2 antibody, Nucleobindin -2, Nucleobindin 2, Nucleobindin 2, NUCB2 antibody, Nucleobindin 2 antibody, Nucleobindin -2 antibody
Specificity Nucleobindin 2 antibody was raised against the middle region of NUCB2
Cross Reactivity Human
Applications IHC, WB
Immunogen Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Assay Information Nucleobindin 2 Blocking Peptide, catalog no. 33R-6232, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 2 antibody


Immunohistochemical staining using Nucleobindin 2 antibody (70R-1577)

Nucleobindin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUCB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nucleobindin-2 is a calcium-binding EF-hand protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Nucleobindin 2 antibody (70R-1577) | Nucleobindin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using Nucleobindin 2 antibody (70R-1577) | Nucleobindin 2 antibody (70R-1577) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors