NUDT16L1 antibody (70R-1265)

Rabbit polyclonal NUDT16L1 antibody

Synonyms Polyclonal NUDT16L1 antibody, Anti-NUDT16L1 antibody, NUDTL1 16 antibody, NUDTL1 16, SDOS antibody, NUDTL1-16, Nudix 16L1 antibody, MGC11275 antibody, NUDT16L1, NUDTL1-16 antibody, Nucleoside Diphosphate Linked Moiety X-Type Motif 16-Like 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NUDT16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE
Assay Information NUDT16L1 Blocking Peptide, catalog no. 33R-3430, is also available for use as a blocking control in assays to test for specificity of this NUDT16L1 antibody

Images

Western Blot analysis using NUDT16L1 antibody (70R-1265)

Western Blot showing NUDT16L1 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUDT16L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NUDT16L1 antibody (70R-1265) | Western Blot showing NUDT16L1 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors