NUDT18 antibody (70R-2163)

Rabbit polyclonal NUDT18 antibody

Synonyms Polyclonal NUDT18 antibody, Anti-NUDT18 antibody, NUDT18, NUDT 18, Nudix 18 antibody, FLJ22494 antibody, NUDT-18 antibody, Nucleoside Diphosphate Linked Moiety X-Type Motif 18 antibody, NUDT-18, NUDT 18 antibody
Cross Reactivity Human
Applications WB
Immunogen NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM
Assay Information NUDT18 Blocking Peptide, catalog no. 33R-4396, is also available for use as a blocking control in assays to test for specificity of this NUDT18 antibody

Images

Western Blot analysis using NUDT18 antibody (70R-2163)

NUDT18 antibody (70R-2163) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUDT18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUDT18 belongs to the Nudix hydrolase family. It contains 1 nudix hydrolase domain. NUDT18 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NUDT18 antibody (70R-2163) | NUDT18 antibody (70R-2163) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors