NUDT9 antibody (70R-5103)

Rabbit polyclonal NUDT9 antibody

Synonyms Polyclonal NUDT9 antibody, Anti-NUDT9 antibody, NUDT-9, NUDT9, NUDT 9, NUDT 9 antibody, Nudix 9 antibody, MGC3037 antibody, Nucleoside Diphosphate Linked Moiety X-Type Motif 9 antibody, NUDT-9 antibody, NUDT10 antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA
Assay Information NUDT9 Blocking Peptide, catalog no. 33R-4873, is also available for use as a blocking control in assays to test for specificity of this NUDT9 antibody


Immunohistochemical staining using NUDT9 antibody (70R-5103)

NUDT9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUDT9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NUDT9 antibody (70R-5103) | NUDT9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using NUDT9 antibody (70R-5103) | NUDT9 antibody (70R-5103) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors