NUP155 antibody (70R-2127)

Rabbit polyclonal NUP155 antibody raised against the middle region of NUP155

Synonyms Polyclonal NUP155 antibody, Anti-NUP155 antibody, NUP155, KIAA0791 antibody, NUP-155 antibody, NUP 155 antibody, Nucleoporin 155Kda antibody, N155 antibody, NUP 155, NUP-155
Specificity NUP155 antibody was raised against the middle region of NUP155
Cross Reactivity Human
Applications WB
Immunogen NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY
Assay Information NUP155 Blocking Peptide, catalog no. 33R-4155, is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody

Images

Western Blot analysis using NUP155 antibody (70R-2127)

NUP155 antibody (70R-2127) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 147 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUP155 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NUP155 antibody (70R-2127) | NUP155 antibody (70R-2127) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors