NUP43 antibody (70R-2178)

Rabbit polyclonal NUP43 antibody raised against the middle region of NUP43

Synonyms Polyclonal NUP43 antibody, Anti-NUP43 antibody, NUP-43, NUP-43 antibody, bA350J20.1 antibody, FLJ13287 antibody, Nucleoporin 43Kda antibody, NUP43, NUP 43, p42 antibody, NUP 43 antibody
Specificity NUP43 antibody was raised against the middle region of NUP43
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI
Assay Information NUP43 Blocking Peptide, catalog no. 33R-3830, is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody

Images

Western Blot analysis using NUP43 antibody (70R-2178)

NUP43 antibody (70R-2178) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUP43 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NUP43 antibody (70R-2178) | NUP43 antibody (70R-2178) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors