NXF3 antibody (70R-1364)

Rabbit polyclonal NXF3 antibody raised against the C terminal of NXF3

Synonyms Polyclonal NXF3 antibody, Anti-NXF3 antibody, Nuclear Rna Export Factor 3 antibody, NXF 3, NXF-3 antibody, NXF 3 antibody, NXF3, NXF-3
Specificity NXF3 antibody was raised against the C terminal of NXF3
Cross Reactivity Human
Applications IHC, WB
Immunogen NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS
Assay Information NXF3 Blocking Peptide, catalog no. 33R-8801, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody

Images

Western Blot analysis using NXF3 antibody (70R-1364)

NXF3 antibody (70R-1364) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NXF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NXF3 antibody (70R-1364) | NXF3 antibody (70R-1364) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using NXF3 antibody (70R-1364) | NXF3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors