NXF3 antibody (70R-4659)

Rabbit polyclonal NXF3 antibody raised against the N terminal of NXF3

Synonyms Polyclonal NXF3 antibody, Anti-NXF3 antibody, NXF3, NXF-3, Nuclear Rna Export Factor 3 antibody, NXF 3, NXF-3 antibody, NXF 3 antibody
Specificity NXF3 antibody was raised against the N terminal of NXF3
Cross Reactivity Human
Applications WB
Immunogen NXF3 antibody was raised using the N terminal of NXF3 corresponding to a region with amino acids SLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDG
Assay Information NXF3 Blocking Peptide, catalog no. 33R-8615, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody


Western Blot analysis using NXF3 antibody (70R-4659)

NXF3 antibody (70R-4659) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NXF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NXF3 antibody (70R-4659) | NXF3 antibody (70R-4659) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors