NXNL2 antibody (70R-4157)

Rabbit polyclonal NXNL2 antibody raised against the middle region of NXNL2

Synonyms Polyclonal NXNL2 antibody, Anti-NXNL2 antibody, NXNL 2 antibody, NXNL-2, Nucleoredoxin-Like 2 antibody, C9orf121 antibody, NXNL2, NXNL 2, NXNL-2 antibody
Specificity NXNL2 antibody was raised against the middle region of NXNL2
Cross Reactivity Human
Applications WB
Immunogen NXNL2 antibody was raised using the middle region of NXNL2 corresponding to a region with amino acids SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC
Assay Information NXNL2 Blocking Peptide, catalog no. 33R-8291, is also available for use as a blocking control in assays to test for specificity of this NXNL2 antibody

Images

Western Blot analysis using NXNL2 antibody (70R-4157)

NXNL2 antibody (70R-4157) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NXNL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of NXNL2 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NXNL2 antibody (70R-4157) | NXNL2 antibody (70R-4157) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors