OAT antibody (70R-5318)

Rabbit polyclonal OAT antibody

Synonyms Polyclonal OAT antibody, Anti-OAT antibody, Gyrate Atrophy antibody, HOGA antibody, Ornithine Aminotransferase antibody, DKFZp781A11155 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV
Assay Information OAT Blocking Peptide, catalog no. 33R-8230, is also available for use as a blocking control in assays to test for specificity of this OAT antibody


Western Blot analysis using OAT antibody (70R-5318)

OAT antibody (70R-5318) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OAT antibody (70R-5318) | OAT antibody (70R-5318) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors