OAZ2 antibody (70R-4322)

Rabbit polyclonal OAZ2 antibody raised against the middle region of OAZ2

Synonyms Polyclonal OAZ2 antibody, Anti-OAZ2 antibody, AZ2 antibody, Ornithine Decarboxylase Antizyme 2 antibody, OAZ 2 antibody, OAZ 2, OAZ-2, OAZ-2 antibody, OAZ2
Specificity OAZ2 antibody was raised against the middle region of OAZ2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL
Assay Information OAZ2 Blocking Peptide, catalog no. 33R-7012, is also available for use as a blocking control in assays to test for specificity of this OAZ2 antibody


Western Blot analysis using OAZ2 antibody (70R-4322)

OAZ2 antibody (70R-4322) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OAZ2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OAZ2 antibody (70R-4322) | OAZ2 antibody (70R-4322) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors