OGT antibody (70R-2046)

Rabbit polyclonal OGT antibody

Synonyms Polyclonal OGT antibody, Anti-OGT antibody, FLJ23071 antibody, MGC22921 antibody, O-Linked N-Acetylglucosamine antibody, Glcnac Transferase antibody, HRNT1 antibody, O-GLCNAC antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OGT antibody was raised using a synthetic peptide corresponding to a region with amino acids ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE
Assay Information OGT Blocking Peptide, catalog no. 33R-1533, is also available for use as a blocking control in assays to test for specificity of this OGT antibody


Western Blot analysis using OGT antibody (70R-2046)

OGT antibody (70R-2046) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OGT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OGT antibody (70R-2046) | OGT antibody (70R-2046) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors