OLFML1 antibody (70R-5401)

Rabbit polyclonal OLFML1 antibody raised against the middle region of OLFML1

Synonyms Polyclonal OLFML1 antibody, Anti-OLFML1 antibody, OLFML 1 antibody, UNQ564 antibody, OLFML-1 antibody, Olfactomedin-Like 1 antibody, OLFML 1, OLFML1, OLFML-1
Specificity OLFML1 antibody was raised against the middle region of OLFML1
Cross Reactivity Human
Applications WB
Immunogen OLFML1 antibody was raised using the middle region of OLFML1 corresponding to a region with amino acids LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH
Assay Information OLFML1 Blocking Peptide, catalog no. 33R-4820, is also available for use as a blocking control in assays to test for specificity of this OLFML1 antibody


Western Blot analysis using OLFML1 antibody (70R-5401)

OLFML1 antibody (70R-5401) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OLFML1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of OLFML1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OLFML1 antibody (70R-5401) | OLFML1 antibody (70R-5401) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors