Optineurin antibody (70R-2621)

Rabbit polyclonal Optineurin antibody raised against the C terminal of OPTN

Synonyms Polyclonal Optineurin antibody, Anti-Optineurin antibody, TFIIIA-INTP antibody, FIP2 antibody, NRP antibody, OPTN antibody, HIP7 antibody, GLC1E antibody, HYPL antibody
Specificity Optineurin antibody was raised against the C terminal of OPTN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII
Assay Information Optineurin Blocking Peptide, catalog no. 33R-8367, is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody


Western blot analysis using Optineurin antibody (70R-2621)

Recommended OPTN Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OPTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using Optineurin antibody (70R-2621) | Recommended OPTN Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors