OTUB1 antibody (70R-4421)

Rabbit polyclonal OTUB1 antibody raised against the middle region of OTUB1

Synonyms Polyclonal OTUB1 antibody, Anti-OTUB1 antibody, HSPC263 antibody, FLJ40710 antibody, OTUB1, OTU1 antibody, FLJ20113 antibody, OTUB 1 antibody, OTB1 antibody, MGC111158 antibody, OTUB-1 antibody, OTUB-1, MGC4584 antibody, OTUB 1, Otu Domain Ubiquitin Aldehyde Binding 1 antibody
Specificity OTUB1 antibody was raised against the middle region of OTUB1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen OTUB1 antibody was raised using the middle region of OTUB1 corresponding to a region with amino acids KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
Assay Information OTUB1 Blocking Peptide, catalog no. 33R-4432, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody

Images

Western Blot analysis using OTUB1 antibody (70R-4421)

OTUB1 antibody (70R-4421) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OTUB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OTUB1 antibody (70R-4421) | OTUB1 antibody (70R-4421) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors