OXCT1 antibody (70R-5323)

Rabbit polyclonal OXCT1 antibody raised against the middle region of OXCT1

Synonyms Polyclonal OXCT1 antibody, Anti-OXCT1 antibody, OXCT-1 antibody, SCOT antibody, OXCT1, OXCT 1 antibody, 3-Oxoacid Coa Transferase 1 antibody, OXCT-1, OXCT antibody, OXCT 1
Specificity OXCT1 antibody was raised against the middle region of OXCT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN
Assay Information OXCT1 Blocking Peptide, catalog no. 33R-3442, is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody


Western Blot analysis using OXCT1 antibody (70R-5323)

OXCT1 antibody (70R-5323) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OXCT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OXCT1 antibody (70R-5323) | OXCT1 antibody (70R-5323) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors