OXCT2 antibody (70R-5373)

Rabbit polyclonal OXCT2 antibody raised against the middle region of OXCT2

Synonyms Polyclonal OXCT2 antibody, Anti-OXCT2 antibody, FKSG25 antibody, SCOT-T antibody, FLJ00030 antibody, OXCT 2 antibody, OXCT-2, OXCT 2, OXCT2, 3-Oxoacid Coa Transferase 2 antibody, OXCT-2 antibody
Specificity OXCT2 antibody was raised against the middle region of OXCT2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
Assay Information OXCT2 Blocking Peptide, catalog no. 33R-3340, is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody


Western Blot analysis using OXCT2 antibody (70R-5373)

OXCT2 antibody (70R-5373) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OXCT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC, which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC, which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OXCT2 antibody (70R-5373) | OXCT2 antibody (70R-5373) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors