P2RX1 antibody (70R-1546)

Rabbit polyclonal P2RX1 antibody raised against the middle region of P2RX1

Synonyms Polyclonal P2RX1 antibody, Anti-P2RX1 antibody, PRX1 2, PRX1 2 antibody, Purinergic Receptor P2X Ligand-Gated Ion Channel 1 antibody, P2X1 antibody, PRX1-2 antibody, P2RX1, PRX1-2
Specificity P2RX1 antibody was raised against the middle region of P2RX1
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen P2RX1 antibody was raised using the middle region of P2RX1 corresponding to a region with amino acids VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
Assay Information P2RX1 Blocking Peptide, catalog no. 33R-9880, is also available for use as a blocking control in assays to test for specificity of this P2RX1 antibody


Immunohistochemical staining using P2RX1 antibody (70R-1546)

P2RX1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of pancreatic acinus (arrows) in Human Pancreas. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of P2RX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P2RX1 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using P2RX1 antibody (70R-1546) | P2RX1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of pancreatic acinus (arrows) in Human Pancreas. Magnification is at 400X
  • Western Blot analysis using P2RX1 antibody (70R-1546) | P2RX1 antibody (70R-1546) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors