P450 antibody (70R-1780)

Rabbit polyclonal P450 antibody

Synonyms Polyclonal P450 antibody, Anti-P450 antibody, P-450, POR antibody, P 450 antibody, P450R antibody, P-450 antibody, FLJ26468 antibody, DKFZp686G04235 antibody, Cytochrome Oxidoreductase antibody, P 450, CPR antibody, CYPOR antibody, P450
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen P450 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT
Assay Information P450 Blocking Peptide, catalog no. 33R-3924, is also available for use as a blocking control in assays to test for specificity of this P450 antibody


Immunohistochemical staining using P450 antibody (70R-1780)

P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of POR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using P450 antibody (70R-1780) | P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using P450 antibody (70R-1780) | P450 antibody (70R-1780) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using P450 antibody (70R-1780) | P450 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors