PABPC1 antibody (70R-4653)

Rabbit polyclonal PABPC1 antibody

Synonyms Polyclonal PABPC1 antibody, Anti-PABPC1 antibody, PABPC2 antibody, PABP1 antibody, PABPC-1, PABPC-1 antibody, PABPC 1 antibody, PABPC1, Poly A binding protein 1 antibody, PABPL1 antibody, PABPC 1, PAB1 antibody, PABP antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
Assay Information PABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody


Western Blot analysis using PABPC1 antibody (70R-4653)

PABPC1 antibody (70R-4653) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PABPC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PABPC1 antibody (70R-4653) | PABPC1 antibody (70R-4653) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors