PABPC5 antibody (70R-4840)

Rabbit polyclonal PABPC5 antibody

Synonyms Polyclonal PABPC5 antibody, Anti-PABPC5 antibody, Poly A binding protein 5 antibody, PABPC5, PABP5 antibody, PABPC-5, PABPC 5, PABPC-5 antibody, PABPC 5 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
Assay Information PABPC5 Blocking Peptide, catalog no. 33R-1849, is also available for use as a blocking control in assays to test for specificity of this PABPC5 antibody


Western Blot analysis using PABPC5 antibody (70R-4840)

PABPC5 antibody (70R-4840) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PABPC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PABPC5 antibody (70R-4840) | PABPC5 antibody (70R-4840) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors