PACRG antibody (70R-2550)

Rabbit polyclonal PACRG antibody raised against the middle region of PACRG

Synonyms Polyclonal PACRG antibody, Anti-PACRG antibody, Park2 Co-Regulated antibody, GLUP antibody, RP3-495O10.2 antibody, HAK005771 antibody, PARK2CRG antibody, FLJ32724 antibody
Specificity PACRG antibody was raised against the middle region of PACRG
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
Assay Information PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody


Western Blot analysis using PACRG antibody (70R-2550)

PACRG antibody (70R-2550) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PACRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PACRG antibody (70R-2550) | PACRG antibody (70R-2550) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors