PAIP1 antibody (70R-4907)

Rabbit polyclonal PAIP1 antibody

Synonyms Polyclonal PAIP1 antibody, Anti-PAIP1 antibody, PAIP 1, PAIP-1 antibody, PAIP-1, PAIP1, Poly A binding protein interacting protein 1 antibody, MGC12360 antibody, PAIP 1 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS
Assay Information PAIP1 Blocking Peptide, catalog no. 33R-6406, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Images

Western Blot analysis using PAIP1 antibody (70R-4907)

PAIP1 antibody (70R-4907) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PAIP1 antibody (70R-4907) | PAIP1 antibody (70R-4907) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors