PAOX antibody (70R-3320)

Rabbit polyclonal PAOX antibody

Synonyms Polyclonal PAOX antibody, Anti-PAOX antibody, DKFZp434J245 antibody, RP11-122K13.11 antibody, Exo-N4-Amino antibody, MGC45464 antibody, Polyamine Oxidase antibody, PAO antibody
Cross Reactivity Human
Applications WB
Immunogen PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA
Assay Information PAOX Blocking Peptide, catalog no. 33R-3850, is also available for use as a blocking control in assays to test for specificity of this PAOX antibody

Images

Western Blot analysis using PAOX antibody (70R-3320)

PAOX antibody (70R-3320) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAOX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PAOX antibody (70R-3320) | PAOX antibody (70R-3320) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors